PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00132825001
Common NameGSBRNA2T00132825001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 248aa    MW: 27196.9 Da    PI: 9.5555
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00132825001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like962.9e-30101154155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  GSBRNA2T00132825001 101 RPRLVWTPQLHKRFVDAVGHL-GIKNAVPKTIMQLMSVEGLTRENVASHLQKYRL 154
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.85E-2098158IPR009057Homeodomain-like
PROSITE profilePS512949.1998157IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-30100159IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-24102154IPR006447Myb domain, plants
PfamPF002496.6E-7104153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MREETPNWLV RWEEELPSPE ELIPISQTLI TPHLALAFQI GSHNNHSSPK RTVAMYHQKL  60
QPAATPTPTM MNSDFAVDSS TDLGSGGGGG GGEEPARTLK RPRLVWTPQL HKRFVDAVGH  120
LGIKNAVPKT IMQLMSVEGL TRENVASHLQ KYRLYLRRMQ GGNDNGVSGG HVIVSDSATD  180
RLFASSPVPA HLLSHEYLMP SPLMNPYLGK HVVTQQNHVV RNLRYEGSEY GNGDGGRKVL  240
KLFPAGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-20100159463ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00132825001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013752095.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB42e-46PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078CXW20.0A0A078CXW2_BRANA; BnaA05g01930D protein
STRINGBra004593.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40970.11e-113G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]